PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 919324
Common NameARALYDRAFT_919324
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 313aa    MW: 33196.3 Da    PI: 6.8448
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
919324genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1222e-3847107262
  zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
             ++++lkcprC+s ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s+
  919324  47 HHQSLKCPRCNSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKAKRSK 107
             57899****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3538105IPR003851Zinc finger, Dof-type
PfamPF027015.9E-3349105IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.53451105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105389IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MQDIHDYSMT GVGGGGGGGG RFFGGGMGGG GGGDRRMRAH QNNILNHHQS LKCPRCNSLN  60
TKFCYYNNYN LSQPRHFCKN CRRYWTKGGV LRNVPVGGGC RKAKRSKTKQ VSSSSSADKP  120
TTTQDDHHVE EKSSTGSHSS SESSSLTASN STTVAAVSVT AAAEVASSVI PGSVIPGFDM  180
PNMKLYGNGI EWSTLLGQGS SDGGVFSDIE GFTAASAIGT TAFGFGGKFV NQDDHLKLEG  240
ETVQQQQFGD RTAQVEFQGR SSDPNMGFEP LDWGSGGGDQ TLFDLTSTVD HAYWSQSQWT  300
ASDQDQNGLY LP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11825GGRFFGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0154720.0AB015472.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MAE1.
GenBankAY0564130.0AY056413.1 Arabidopsis thaliana AT5g60850/mae1_100 mRNA, complete cds.
GenBankAY0817090.0AY081709.1 Arabidopsis thaliana AT5g60850/mae1_100 mRNA, complete cds.
GenBankAY0858560.0AY085856.1 Arabidopsis thaliana clone 19080 mRNA, complete sequence.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002864708.10.0hypothetical protein ARALYDRAFT_919324
SwissprotQ8LDR01e-174DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLD7MUE80.0D7MUE8_ARALL; Putative uncharacterized protein
STRINGscaffold_802724.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44822656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.11e-163OBF binding protein 4